Protein Info for BPHYT_RS29870 in Burkholderia phytofirmans PsJN

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02558: ApbA" amino acids 3 to 104 (102 residues), 78.4 bits, see alignment E=4.7e-26 PF08546: ApbA_C" amino acids 196 to 317 (122 residues), 85.9 bits, see alignment E=3e-28

Best Hits

Swiss-Prot: 59% identical to PANE_RHILO: Putative 2-dehydropantoate 2-reductase (mll6982) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 100% identity to bpy:Bphyt_6024)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.169

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T888 at UniProt or InterPro

Protein Sequence (325 amino acids)

>BPHYT_RS29870 2-dehydropantoate 2-reductase (Burkholderia phytofirmans PsJN)
MKICVFGAGAIGGLMGVQLARAGADVSFVARGPHLAAMREHGARLIMDGETFSAPVRCTS
DPRELGVQDFVIITLKAHSLPGVVEAMQPLLGKHTAVVTGVNGIPYWYFYQHGGRFAGTR
LASVDPDGNQWTRLGPERAIGCVLYPAAEIVEPGVIKHVYGKKFPIGEPSGERTPRIQQL
HEIMQAAGFEAPIRDNIRDEIWLKLWGNLCFNPISALTHATLDVLTSDPGTRAVSRTMML
EAKRIAEQFGVHFRVDVEKRIDGAGAVGAHKTSTLVDLENRRPMEIDPLLTVVQEMGHLV
AEPTPTIDVVLALIKLRERMALQGD