Protein Info for BPHYT_RS29865 in Burkholderia phytofirmans PsJN

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 11 to 459 (449 residues), 452 bits, see alignment E=3e-139 TIGR03023: undecaprenyl-phosphate glucose phosphotransferase" amino acids 13 to 459 (447 residues), 498.2 bits, see alignment E=3.1e-153 PF13727: CoA_binding_3" amino acids 55 to 232 (178 residues), 167.4 bits, see alignment E=3.3e-53 PF02397: Bac_transf" amino acids 268 to 451 (184 residues), 219.9 bits, see alignment E=1.9e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6023)

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T887 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BPHYT_RS29865 sugar transferase (Burkholderia phytofirmans PsJN)
MAEMESVLARLLDAVLIALSAALAELLFVPGSGHSLLEGAFVALDMAFAVLLLPWFGVYD
SWRGRSKWRLSVSLVFGWIAVQVCGLAMLFLLHRAASVSRLWCVSWTVIAAVALVSSRWA
VHAVLSRMRRGGGNLRMVAVVGAGAHRDAVVANIMSSPDAGFRAVATFNTRQDGESELNG
LPSFERFRDFADWVRRERIEEVWLALAMSEEETVLTVLDEFSHDLVNLRFIPDVRSLAMF
DRNVIDLIGAPAINLMASPMTPYALVQKAVFDRLFASVALLALLPVMLSIAVAVKVTSKG
PVLFTQRRKGADGRVFRIYKFRSMREHVARPGVVLQARRGDPRVTRVGAFLRRTSLDELP
QFLNVLRGEMSVVGPRPHAIEHDDQYRGVVDGYIHRYRIKPGITGWAQVNGFRGETDRVE
KMQARVEHDLYYLRNWSFGLDMRIVLATVVKGLLHRNAY