Protein Info for BPHYT_RS29840 in Burkholderia phytofirmans PsJN

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 297 to 320 (24 residues), see Phobius details amino acids 329 to 358 (30 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 397 to 418 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 20 to 288 (269 residues), 128.1 bits, see alignment E=6.6e-41 PF13440: Polysacc_synt_3" amino acids 43 to 331 (289 residues), 23.9 bits, see alignment E=3.5e-09 PF14667: Polysacc_synt_C" amino acids 341 to 419 (79 residues), 34.8 bits, see alignment E=2.5e-12

Best Hits

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 100% identity to bpy:Bphyt_6018)

Predicted SEED Role

"Membrane protein involved in the export of O-antigen, teichoic acid lipoteichoic acids"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T882 at UniProt or InterPro

Protein Sequence (433 amino acids)

>BPHYT_RS29840 polysaccharide biosynthesis protein (Burkholderia phytofirmans PsJN)
MSDRRAVGNMQVPNAPRIRTNFVAMMVWQIGNYLVPLVSFPYLTRVLGAENFGMLGYATA
IATYGMLVTEWGFFLSGPKAVVERRGDPEALNELVWSTMAAKASLCVIAFSVLLVVAHYD
RKLASVFPVVLAAWPMVIGNVFTLNWLLQGLERFPVFATVALAGRFAALPLTFVFVRDSD
DVAFAAGIQGGAAVCTGVFSLVAARRMGVLRRPSVSARSAMQRIKESADMFVSSASVSLF
GVTNAVILASMTTPYQVGIYTAADKLKTVANMVPAQINTVCYPRITSLFNVQPRSAARLT
VVGALATVLATLAGLIVVGRISAPLTTLILGGGYAGAASLLNMLCLATVFGNLAYFLGLQ
VLVPFGNARFRSLSMLAAGVLNVGLAIVLTPRFGAQGAAVSLLVAEAMLLVVYVSMLLSK
PALRHHFTQLLNR