Protein Info for BPHYT_RS29830 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 60 to 78 (19 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 174 (26 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 219 to 250 (32 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 349 to 366 (18 residues), see Phobius details amino acids 386 to 418 (33 residues), see Phobius details PF13425: O-antigen_lig" amino acids 60 to 251 (192 residues), 39.5 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6016)

Predicted SEED Role

"FIG00455774: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T880 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BPHYT_RS29830 hypothetical protein (Burkholderia phytofirmans PsJN)
MSNAVIARRMSASTARWALQSSTSITWALFAGGLALSPLADFLSVRAAHGFDSEGGDARF
SLVVRGTMVAGLLLLLLVSGRIRLSSWRTALLAMVAITASAATYAFADMSSVEFAQQAVF
VLKVFSFFICLAALSGMGDRQLEKLEPFMRLTLLAYAVAIVMGAVFSIDLFRSYWADTQI
RSGYKGIVYAQNEASALMIVGLAYGLLRVLTFGWSAWSGVLVGTIVLASCLVGTKAAMGG
TIAMICSYFFCRHNVPQATVRALTFVGLLAVLAAAAYFSLPGVQSAADLSFQYFMYQHDH
VNSGGILTMVLSGRDVKFLNVWDEVAKDGYVPLLTGGYPVVRYLVEIDVPDLVLAMGLPV
CAFYLGDLGKAFVCGEGGAESRFGRWFFIVLMATACTAGHILVSAIVSPYLAMIAVLIKR
AARNRRYLIEGPHDE