Protein Info for BPHYT_RS29725 in Burkholderia phytofirmans PsJN

Annotation: aromatic compound catabolic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF14539: DUF4442" amino acids 43 to 136 (94 residues), 26.1 bits, see alignment E=1.3e-09 TIGR00369: uncharacterized domain 1" amino acids 58 to 174 (117 residues), 76 bits, see alignment E=1.3e-25 PF13622: 4HBT_3" amino acids 84 to 172 (89 residues), 26.6 bits, see alignment E=8.8e-10 PF03061: 4HBT" amino acids 89 to 165 (77 residues), 54.3 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5993)

Predicted SEED Role

"uncharacterized domain 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T858 at UniProt or InterPro

Protein Sequence (182 amino acids)

>BPHYT_RS29725 aromatic compound catabolic protein (Burkholderia phytofirmans PsJN)
MANKEQTLERWIAEERDVLVKINAGPGPGLASPEQIAGKSGLEILQAIVAGELPYAAIAK
TLDFTLMEVAAGRAVFQGTPLAQHLNPLGTIHGGWMATLLDSALGCSVHTMMPPGRGYTT
AELSVNYVKAVTPRLQRVRAEGKVIHCGRQLATAEARLVGPDGTLYAHATTTCLVFELPP
NR