Protein Info for BPHYT_RS29655 in Burkholderia phytofirmans PsJN

Annotation: polysaccharide deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 24 to 45 (22 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details PF01522: Polysacc_deac_1" amino acids 87 to 207 (121 residues), 93.8 bits, see alignment E=3.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5979)

Predicted SEED Role

"Polysaccharide deacetylase" in subsystem Polysaccharide deacetylases or Predicted carbohydrate hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T844 at UniProt or InterPro

Protein Sequence (285 amino acids)

>BPHYT_RS29655 polysaccharide deacetylase (Burkholderia phytofirmans PsJN)
MKQLSTPPHGVHGAPSRRWPQTGYPAMLTATAAWHVIVLAGWLIAPAAWPWWVAAIFVNH
AIFTVAGLLPRTSLLGPNWTRLPAHARNADAIALTIDDGPDPAVTPQVLDLLDTFGVRAT
FFCIGAMAQRYPELARDIVARGHALENHSQVHVHTFSVTLPGALTREIDAAQCTLEALSG
ERPMFFRAPAGLRNIFLEPVLRKLDLRLAAWTRRGYDTRERDPQVVARRLLDGLAPRDIL
LLHDGNAALTAEGTPLILAVLPRVIDAARQRHLRFVTLREARVDN