Protein Info for BPHYT_RS29540 in Burkholderia phytofirmans PsJN
Annotation: aldolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to Y1201_CAUVC: Putative aldolase class 2 protein CC_1201 (CC_1201) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5956)Predicted SEED Role
"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T822 at UniProt or InterPro
Protein Sequence (271 amino acids)
>BPHYT_RS29540 aldolase (Burkholderia phytofirmans PsJN) MQTMQISDAALEARAARSARSASEQHVREELAALYRLAAHFRMTDMIDTHITARLPSAPG EPAAFLINRYGVLFHEMRASDLVKIDHQGKVVDERARTEPALFRVNAAGFTIHSAIHAAR DDLHFVIHTHTAAGTAVSAQEQGLLPISQHALKFYGKLGYHDYEGIALELGERERLVRDL GTCKAMILRNHGLLAAGATAAEAFEEIYFLERACQAQIQALAGGSALRIPPREVCELTAS QFDREDSAEIAELAWQAALRLIDDPKSDYRA