Protein Info for BPHYT_RS29410 in Burkholderia phytofirmans PsJN

Annotation: HPr kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF07005: SBD_N" amino acids 10 to 239 (230 residues), 262.1 bits, see alignment E=5.2e-82 PF17042: NBD_C" amino acids 267 to 424 (158 residues), 155.1 bits, see alignment E=2.5e-49

Best Hits

Swiss-Prot: 76% identical to OTNK_BURM1: 3-oxo-tetronate kinase (otnK) from Burkholderia multivorans (strain ATCC 17616 / 249)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5930)

MetaCyc: 72% identical to 3-dehydrotetronate 4-kinase monomer (Cupriavidus necator H16)
RXN-18594 [EC: 2.7.1.217]; 2.7.1.217 [EC: 2.7.1.217]

Predicted SEED Role

"FIG00641944: hypothetical protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.217

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFF1 at UniProt or InterPro

Protein Sequence (436 amino acids)

>BPHYT_RS29410 HPr kinase (Burkholderia phytofirmans PsJN)
MTATTKRALLGCIADDFTGATDLANMLVRGGMRTVQTIGVPASNETVEADALVVALKSRT
IPAADAVAQSLAALDWLRAQGCRQFFFKYCSTFDSTDAGNIGPVTDALLDALSAEGKAGA
FTIACPAFPENGRTIFRGHLFVGDTLLNASGMENHPLTPMRDANLVSVLQRQTESKVGLV
RYDAVAQGVSAVRDAFDTLRNEGVRMAIADAVSDADLYVLGEACADLTLITGGSGIALGL
PANFRRAGLLKEQADAAQLPQVKGLSAVLAGSASKATNEQVAQWRSARPAFRVDPLAAAR
GENVVEQALAFAQPYLDKAEPMLIYATATPDEVKAVQRQLGVNEAGHLVENTLASIARGL
HERGVRKFVVAGGETSGAVVQALDVHTLRIGAQIDPGVPATATTGAEPLALALKSGNFGT
ADFFEKALRHLNGAAQ