Protein Info for BPHYT_RS29385 in Burkholderia phytofirmans PsJN

Annotation: acetyl-CoA acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to PCAF_PSEAE: Beta-ketoadipyl-CoA thiolase (pcaF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to bpy:Bphyt_5925)

MetaCyc: 82% identical to 3-oxoadipyl-CoA thiolase (Cupriavidus necator H16)
3-oxoadipyl-CoA thiolase. [EC: 2.3.1.174]

Predicted SEED Role

"Acetyl-CoA acetyltransferase (EC 2.3.1.9) @ Beta-ketoadipyl CoA thiolase (EC 2.3.1.-)" (EC 2.3.1.-, EC 2.3.1.9)

MetaCyc Pathways

oleate β-oxidation (29/35 steps found)
superpathway of phenylethylamine degradation (11/11 steps found)
aromatic compounds degradation via β-ketoadipate (9/9 steps found)
phenylacetate degradation I (aerobic) (9/9 steps found)
superpathway of salicylate degradation (7/7 steps found)
catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
adipate degradation (5/5 steps found)
acetyl-CoA fermentation to butanoate (6/7 steps found)
benzoyl-CoA degradation I (aerobic) (6/7 steps found)
ketolysis (3/3 steps found)
polyhydroxybutanoate biosynthesis (3/3 steps found)
3-oxoadipate degradation (2/2 steps found)
acetoacetate degradation (to acetyl CoA) (2/2 steps found)
adipate biosynthesis (4/5 steps found)
ketogenesis (4/5 steps found)
(2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
pyruvate fermentation to butanol II (engineered) (4/6 steps found)
1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
valproate β-oxidation (6/9 steps found)
glycerol degradation to butanol (11/16 steps found)
(R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
glutaryl-CoA degradation (3/5 steps found)
pyruvate fermentation to acetone (3/5 steps found)
photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
2-deoxy-D-ribose degradation II (5/8 steps found)
L-tryptophan degradation III (eukaryotic) (10/15 steps found)
pyruvate fermentation to hexanol (engineered) (7/11 steps found)
toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
mandelate degradation to acetyl-CoA (12/18 steps found)
4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
isopropanol biosynthesis (engineered) (2/5 steps found)
pyruvate fermentation to butanol I (4/8 steps found)
pyruvate fermentation to butanoate (3/7 steps found)
L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
2-methylpropene degradation (2/8 steps found)
3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
mevalonate pathway II (haloarchaea) (1/7 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
L-lysine fermentation to acetate and butanoate (3/10 steps found)
methyl tert-butyl ether degradation (3/10 steps found)
4-oxopentanoate degradation (2/9 steps found)
isoprene biosynthesis II (engineered) (1/8 steps found)
mevalonate pathway III (Thermoplasma) (1/8 steps found)
mevalonate pathway IV (archaea) (1/8 steps found)
ethylmalonyl-CoA pathway (3/11 steps found)
L-glutamate degradation VII (to butanoate) (3/12 steps found)
superpathway of aerobic toluene degradation (14/30 steps found)
benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
toluene degradation VI (anaerobic) (3/18 steps found)
superpathway of ergosterol biosynthesis I (5/26 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
superpathway of L-lysine degradation (11/43 steps found)
superpathway of cholesterol biosynthesis (5/38 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.174, 2.3.1.9

Use Curated BLAST to search for 2.3.1.- or 2.3.1.174 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFE4 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BPHYT_RS29385 acetyl-CoA acetyltransferase (Burkholderia phytofirmans PsJN)
MTEAFLCDAIRTPIGRYAGSLSSVRADDLGAVPLKALMERNKDVDWNAIDDVIYGCANQA
GEDNRNVARMSLLLAGLPQGVPGTTVNRLCGSGMDAVGIAARAIKSGEAALMVAGGVESM
SRAPFVMGKAPTAFSRQAEIYDTTIGWRFVNPLMKKLYGVDSMPETGENVATDYNISRAD
QDAFAVRSQQKAARAQRDGTLAQEIVGVTIAQKKGDPITVLQDEHPRETSLETLAKLKGV
VRPDGTVTAGNASGVNDGAAALLLANEETARRFGLTPRARVLGIATAGVAPRVMGIGPAP
ATQKLLARLNMTIDQFDVIELNEAFASQGIAVLRALGVADDDARVNPNGGAIALGHPLGM
SGARLVTTAMYQLHRTQGRFALCTMCIGVGQGIAIAIERV