Protein Info for BPHYT_RS29310 in Burkholderia phytofirmans PsJN

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00248: Aldo_ket_red
  • amino acids 19 to 286 (268 residues), 169.3 bits, E=5.3e-54

Best Hits

Swiss-Prot: 72% identical to PDXI_ECOLI: Pyridoxine 4-dehydrogenase (pdxI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5911)

MetaCyc: 72% identical to pyridoxal reductase (Escherichia coli K-12 substr. MG1655)
Pyridoxine 4-dehydrogenase. [EC: 1.1.1.65]; RXN0-7143 [EC: 1.1.1.65]

Predicted SEED Role

"Aldo-keto reductase"

MetaCyc Pathways

• pyridoxal 5'-phosphate salvage II (plants) (9/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (6/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (5/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.65

Sequence Analysis Tools

See B2TFZ0 at UniProt or InterPro

Protein Sequence (292 amino acids)

>BPHYT_RS29310 oxidoreductase (Burkholderia phytofirmans PsJN)
MSNLSTTDTFPLAGHPVRRMGYGAMQLAGPGVFGPPKDRGAALAVLREAVASGVNHIDTS
DFYGPHITNQLIREALHPYPGDLVIVTKVGAVRGSDGAWLPAFEPADIERGVHDNLRNLG
LDALEVVNMRAMGDIHAPAEGSIEKQVTALAELQQRGLVRHIGLSNVTATQIEEARRIAE
IVCVQNHYNLVHRHDDALIGQLAEAGIAYVPFFPLGGFTPIQSSALSEIAQTLGATPMQV
ALAWLLQRSPNILLIPGTSSVGHLRENLQASQLKLSAQVCAELDAIGGAAQF