Protein Info for BPHYT_RS29150 in Burkholderia phytofirmans PsJN

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF01810: LysE" amino acids 20 to 210 (191 residues), 125.8 bits, see alignment E=7.6e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5879)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFV8 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BPHYT_RS29150 lysine transporter LysE (Burkholderia phytofirmans PsJN)
MIASTFLTADVLIAYSAYFVGTASPGPSNLAIMSLAMSSGRRSALTFALGVVSGSFFWAL
LASLGLSAVLATYSECLVAIKIAGGLYLLWLGFKSARSAFRPKALPTGTARDNEPLKRLY
LRGLLLHLTNPKAILVWLSIVSLAMSPAGGTSHTAPVVLGCMCIGVSVFSSYAVLFSTAS
ARRIYASIRRWLDGSLAIMFGIAGIKLLTSKN