Protein Info for BPHYT_RS29115 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 9 to 32 (24 residues), see Phobius details amino acids 155 to 178 (24 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 3 to 450 (448 residues), 405.8 bits, see alignment E=1.4e-125 PF00672: HAMP" amino acids 178 to 228 (51 residues), 25.8 bits, see alignment 2.2e-09 PF00512: HisKA" amino acids 236 to 300 (65 residues), 55.9 bits, see alignment E=7.1e-19 PF02518: HATPase_c" amino acids 348 to 446 (99 residues), 73.7 bits, see alignment E=3.3e-24 PF14501: HATPase_c_5" amino acids 353 to 443 (91 residues), 29.7 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to bpy:Bphyt_5872)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFV1 at UniProt or InterPro

Protein Sequence (485 amino acids)

>BPHYT_RS29115 histidine kinase (Burkholderia phytofirmans PsJN)
MNRSIARRLALMFALVALFVFTLVGTGLFLVLRTQLEHHLRESLDDRTQIARIIVYHAVT
PEKWRMAREKLTDMTPHDGSTVYAVSSADPYFHYGTPVGGSVVTNWAGGYSRVMPSGGGQ
DMLTSTATLPAYGARPAVQLQVAVSYSPNVRTMRVFGLALAALSALGSLAVLLLSYSVTR
LGLAPLTRLTRDASAVSPNNRSQRLNTASLPLELNDLANSFNGALERLDGAYGRLESFNA
DVAHELRTPVTILIGQTEVALTRNRSVDDLRHTLQSNLEEYERMRAIINDMLFLARADQG
ERATGLVDVSLAAEVAHTLEFLEIPLEEARVRAQLRGDAMARVNRSLFGRACTNLLMNAI
QHCEPDAEISVTIVSDEDQVRVAVANPGEPISPDVLEHLFDRFYRAEVSRTNSRENHGLG
LAIVKAIAEMHRGSVSAQSAHGINTFVFSVAALSPMEAGVPAARSNPSAAADGSGYSSLA
KSKSA