Protein Info for BPHYT_RS29090 in Burkholderia phytofirmans PsJN

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF23441: SDR" amino acids 2 to 202 (201 residues), 37.3 bits, see alignment E=5.3e-13 PF00106: adh_short" amino acids 7 to 191 (185 residues), 175 bits, see alignment E=3.2e-55 PF08659: KR" amino acids 8 to 175 (168 residues), 61.2 bits, see alignment E=3.3e-20 PF01370: Epimerase" amino acids 10 to 181 (172 residues), 22.9 bits, see alignment E=1.3e-08 PF13561: adh_short_C2" amino acids 15 to 241 (227 residues), 195.1 bits, see alignment E=3.7e-61

Best Hits

Swiss-Prot: 52% identical to YKVO_BACSU: Uncharacterized oxidoreductase YkvO (ykvO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5867)

MetaCyc: 37% identical to acetoin reductase subunit (Klebsiella pneumoniae)
RXN-11032 [EC: 1.1.1.304]; 1.1.1.- [EC: 1.1.1.304]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.304 or 1.1.1.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFU6 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BPHYT_RS29090 oxidoreductase (Burkholderia phytofirmans PsJN)
MNRLNGKTAVITGGATGIGRAAAKRFIEEGAFVFIFGRRQEALDAAVAELGPNARAVKGS
VSDPADLDRLYSAVKAERGTLDIVFANAGTGGLLALGKITAEHIDETFDTNVKGAIFTVQ
QALPLMGKGGSIILTGSSAGTTGAPAMSAYSASKAAVRNLARTWAEELKGTGIRVNVLSP
GATATELAKEALGEEGQKVFASMTPLQRMADPAEIAAAAAFLASPDSSFMTASEVAVDGG
LAQL