Protein Info for BPHYT_RS29090 in Burkholderia phytofirmans PsJN

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 7 to 191 (185 residues), 175 bits, E=2.6e-55
• PF08659: KR
  • amino acids 8 to 175 (168 residues), 59.3 bits, E=9.7e-20
• PF01370: Epimerase
  • amino acids 10 to 181 (172 residues), 22.9 bits, E=1e-08
• PF13561: adh_short_C2
  • amino acids 15 to 241 (227 residues), 193.1 bits, E=1.2e-60

Best Hits

Swiss-Prot: 52% identical to YKVO_BACSU: Uncharacterized oxidoreductase YkvO (ykvO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5867)

MetaCyc: 37% identical to acetoin reductase subunit (Klebsiella pneumoniae)
RXN-11032 [EC: 1.1.1.304]; 1.1.1.- [EC: 1.1.1.304]

Predicted SEED Role

"Acetoacetyl-CoA reductase (EC 1.1.1.36)" in subsystem Acetyl-CoA fermentation to Butyrate or Polyhydroxybutyrate metabolism or Serine-glyoxylate cycle (EC 1.1.1.36)

MetaCyc Pathways

• acetyl-CoA fermentation to butanoate (6/7 steps found)
• polyhydroxybutanoate biosynthesis (3/3 steps found)
• pyruvate fermentation to (S)-acetoin (3/3 steps found)
• meso-butanediol biosynthesis I (1/1 steps found)
• (2S)-ethylmalonyl-CoA biosynthesis (3/4 steps found)
• superpathway of 2,3-butanediol biosynthesis (4/6 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (3/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• 4-oxopentanoate degradation (2/9 steps found)
• ethylmalonyl-CoA pathway (3/11 steps found)

KEGG Metabolic Maps

• Butanoate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.36

Use Curated BLAST to search for 1.1.1.304 or 1.1.1.36

Sequence Analysis Tools

See B2TFU6 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BPHYT_RS29090 oxidoreductase (Burkholderia phytofirmans PsJN)
MNRLNGKTAVITGGATGIGRAAAKRFIEEGAFVFIFGRRQEALDAAVAELGPNARAVKGS
VSDPADLDRLYSAVKAERGTLDIVFANAGTGGLLALGKITAEHIDETFDTNVKGAIFTVQ
QALPLMGKGGSIILTGSSAGTTGAPAMSAYSASKAAVRNLARTWAEELKGTGIRVNVLSP
GATATELAKEALGEEGQKVFASMTPLQRMADPAEIAAAAAFLASPDSSFMTASEVAVDGG
LAQL