Protein Info for BPHYT_RS29080 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 52 (16 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 191 to 213 (23 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 5 to 303 (299 residues), 115.2 bits, see alignment E=1.3e-37

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to bpy:Bphyt_5865)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFU4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BPHYT_RS29080 transporter (Burkholderia phytofirmans PsJN)
MHLAGTILPIFAIILTGWVAGASGYMPRALAAPLMRFAYYVAMPSLVFLTIADESLHSLL
DWRFLAAFGGGAMICFVAVMLFARIAWGAGIGKSGILAAAVSMTNTGFVALPILKTLFGQ
AGVLAAAIATVFVGAVMFPILVLLLEIGRYDTSRNIRTATLLRQIATNPVIVATIFGLLW
SILGLELYGPLVSFLTILGEALTPCALFAIGLDLTIAELRERLGLYALLTSLKLAIMPLV
VYGLCLAAGLDRTATVAAVVCAAVPTAKSAYVLAVEYDVEKNVVGAVISMTTLFSVFTLL
AWLYVV