Protein Info for BPHYT_RS29005 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1043 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details amino acids 396 to 419 (24 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details amino acids 471 to 490 (20 residues), see Phobius details amino acids 530 to 554 (25 residues), see Phobius details amino acids 871 to 889 (19 residues), see Phobius details amino acids 896 to 918 (23 residues), see Phobius details amino acids 924 to 945 (22 residues), see Phobius details amino acids 974 to 995 (22 residues), see Phobius details amino acids 1002 to 1027 (26 residues), see Phobius details PF00873: ACR_tran" amino acids 1 to 1027 (1027 residues), 1049.6 bits, see alignment E=0 TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1038 (1038 residues), 1097.5 bits, see alignment E=0 PF03176: MMPL" amino acids 868 to 1033 (166 residues), 27.8 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 100% identity to bpy:Bphyt_5850)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFT0 at UniProt or InterPro

Protein Sequence (1043 amino acids)

>BPHYT_RS29005 transporter (Burkholderia phytofirmans PsJN)
MIRFFVERPVFANVIALIVMLLGAVALINLPIAQYPPITPPTVQVVARFPGASAATLIDR
VALPIETQVNGVENALYMQSTSTNDGTYTLTVTFAVGTDVDKAQVLVQNRVSAATAQLPQ
AVQQQGVTVRKRSTAILQLYTLQSPDPKYDSLFLSNYAVIYLRDTLARLPGVGDVTVFGT
GQYSMRVWLDPQKLSERNLTAADVMNAIQSQSKDVSAGQLGSEPNSGGQAFQLTVTMRGA
LSDPHEFDDIIVKADPDNGGHFVRIRDVGRTELGSSSYGQFFNLDGKPAAGIAIYQLPEA
NALEVGNAVKATMARLAKDMPKGVSYQLPFDTTTFVRQSVIDVYKTLFEAALLVLAVILL
FLQNWRAMLVPATTIPVTIIGTFGAIYMLGFSINLLTLFAIVLAIGIVVDDAIVVVEGIT
QHIEQGKTPKQAAIDAMHELLGPIIGITLVLISVFLPSAFLGGVTGQMYRQFALVVVATT
VISAINAVTLKPVQSVRWLRHARPGKPNIVYRVFDKGYVRVEKGYVRVVSWFVARCGLAL
VIALVLGAGSAFLLTRIPTSFIPLEDQGYVLIAAQLADAASLGRTREASTQIEKRIGAIP
GVSHVVSIGGISPLDNNASLPNSALIYVTLDDWSKRGKGQDLRSLYLRMNSELAKLPDIR
SVVIVPPPIQGLGNSGGVQMQVMLTDGSQNYQRLQDATDALIAGVSKRPELQRVFSPFRA
SVPTVELTLDRAKAESLQVPVGNVFDLLQDYVGSSYVNQFTTFNHTFPVFVQADGAFRRE
TDDIRRLQIRSNSGHMVELGTFTDAHTSVGPAVATLYNLAPAAAINGNPAAGYSTGDAIK
AFEQEAARILPTGIGYEWTAMSYQEKLVGNSAYWVFAVGVLLVFCVLAAQYESWLLPVAV
VLAVPLALLGTAGTLAALGAANNLYTQIGLVLLIALSAKNAILIVEFARHLRAQGVGITE
AAIEAARLRFRPIMMTSFAFILGVVPLVIATGASASARRSLGIAVFSGMLASTCIAVLFI
PSFYVLLQRLGERHAARKTPPDA