Protein Info for BPHYT_RS28995 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details PF00672: HAMP" amino acids 184 to 235 (52 residues), 52.2 bits, see alignment 9.2e-18 PF00512: HisKA" amino acids 240 to 296 (57 residues), 30.6 bits, see alignment 4.2e-11 PF02518: HATPase_c" amino acids 342 to 446 (105 residues), 72.7 bits, see alignment E=5.2e-24

Best Hits

KEGG orthology group: K07638, two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC: 2.7.13.3] (inferred from 100% identity to bpy:Bphyt_5848)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFS8 at UniProt or InterPro

Protein Sequence (451 amino acids)

>BPHYT_RS28995 histidine kinase (Burkholderia phytofirmans PsJN)
MTRPLLHRLLPRTLLARNIALLIALVMLSQVCALGVLLHYVQRPRVERAAAVFATYVTTL
DNLLAATPPAARQGLTARLDARAQAPDEAAAAPPPNLMRAYRTYQRNVFLESLRAHLPAD
MPARWQTLGGQRLWIRMHAPADAPQTPYWIALPIPEDAQGNGLDAAILLSLGLGALAALT
GYLIQRHLNRPLQELTRAARRVSAGETPAPLPTDGPTEIAAVSGAFNQMTQALQQAEATR
ALMLAGISHDIRTPLTKLRLSMAMAMPNDSDSSFVVAAESYLDQIETILQQFMDYAGSGE
REQPEPGDLNALIERLAGDFAGLGHEFELSLATLPAVPYRPISMMRLLMNLMQNAIVYGG
SGLAVRSWATREAVYVAVGDRGKGLSAQELEQLKAPFQRGRNARTHSGGTGLGLAIVERI
ARLHGGSLEFHTREGGGLEVWVVLPLGASTR