Protein Info for BPHYT_RS28915 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 217 to 380 (164 residues), 135.5 bits, see alignment E=7.4e-44 PF00990: GGDEF" amino acids 221 to 377 (157 residues), 118.3 bits, see alignment E=1.4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5832)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGJ2 at UniProt or InterPro

Protein Sequence (381 amino acids)

>BPHYT_RS28915 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MLNPLSILLVTVLSSAMAMAVLGSLWRAAIPGVGYWISANAIAIVALLAFALQGHGSRWL
TFVASNVLLAASLLMVVEGCLRFLGRRVRPWPAYIGLVVVLFGISYWTFAAPDFNARVAL
VSAFHAALYAALAALLLRGRPANRPRYSYYFLAVAALLLCAGHTSRGLMYGFGLLTQSSL
MQVSPSNIIFLALGILAPPCLSIGVVMLAHDRLAERLERLANVDDLTGALSRRAFLAIGD
ALLKASLRTRSPVALAIIDIDSFKAVNDNYGHAAGDQVLSHFATFVARNLRVGDVFGRLG
GEEFGVLCPATTTAEAVSLLDRLRGRLAGAAADELPRGLRYTFSVGVDQLRRDESLAQLM
ARADGALYAAKASGRNRVMAA