Protein Info for BPHYT_RS28860 in Burkholderia phytofirmans PsJN

Annotation: haloacid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF13419: HAD_2" amino acids 15 to 182 (168 residues), 43.5 bits, see alignment E=3.9e-15 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 34 to 174 (141 residues), 50.1 bits, see alignment E=1.9e-17 PF00702: Hydrolase" amino acids 49 to 165 (117 residues), 41.8 bits, see alignment E=1.7e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5821)

Predicted SEED Role

"probable haloacid dehalogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGI5 at UniProt or InterPro

Protein Sequence (223 amino acids)

>BPHYT_RS28860 haloacid dehalogenase (Burkholderia phytofirmans PsJN)
MTLAPVPAAYPKAVLFDLLTALLDSWTSWNRAAGSEQAGRAWRAAYLRLTYGCGSYIAYE
QLVREAAAQVGLPESAALALEADWLTLTPWSGALDALQTLAPHCKLAVVTNCSTRLGEQA
AHLLPVRWDTIVTAEEAGVYKPDPLPYRLALEKLGVQAHEAAFVAGSSYDMFGTAAVGLR
TYWHNRVGLPLVDGAQAPELESPTLDKLVPWVARFGANQHDHA