Protein Info for BPHYT_RS28835 in Burkholderia phytofirmans PsJN

Annotation: 3-(2-hydroxyphenyl) propionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 157 to 181 (25 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 283 to 303 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 377 to 399 (23 residues), see Phobius details amino acids 406 to 427 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 222 (198 residues), 68.6 bits, see alignment E=5e-23 amino acids 247 to 421 (175 residues), 26.3 bits, see alignment E=3.4e-10 PF07690: MFS_1" amino acids 57 to 385 (329 residues), 104.8 bits, see alignment E=4.8e-34

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5816)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGI0 at UniProt or InterPro

Protein Sequence (468 amino acids)

>BPHYT_RS28835 3-(2-hydroxyphenyl) propionic acid transporter (Burkholderia phytofirmans PsJN)
METNTSAGGHERRSQARKATASGWIGSALEYYDFFIYAQAAALIFPQLFFPSGNPKIAIV
ASLATYGVGYVARPIGAVVLGHWGDTHGRKNVLLVCMFLMGFSTMAVAFLPTYHSAGLLA
PALLVVLRLIQGFAVAGEISGASSMILEHAPFGRRGYYASFTLQGVQAGQILAAAVFLPL
AYFMEESSFNSWGWRIPFLLSAVVLIAGYYIRREVHETPAFAKEDASGSVPKSPIVEAFR
YNWPDMVRVILCSLMNVIPVVATIFGAAYAVQASYGIGFSKSVYLWIPVIGNIVAVLVIP
YVGNLSDRVGRRLPIVVGALGAGLLSFGYLYAISIRNVPLAIVMSILMWGIIYQGYNAIF
PSFYPELFPTRSRVSAMAIGQNIGTTITALLPALFAYVAPPGSTNVPLIIGTITFAITIV
AAVTAWTARENYRVRLSDLGEPNAVPIDKLSYDRMRAETMAETKKALA