Protein Info for BPHYT_RS28755 in Burkholderia phytofirmans PsJN

Annotation: 3-(2-hydroxyphenyl) propionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 55 to 79 (25 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 231 (208 residues), 75.3 bits, see alignment E=4.7e-25 amino acids 268 to 437 (170 residues), 27.4 bits, see alignment E=1.6e-10 PF07690: MFS_1" amino acids 29 to 389 (361 residues), 101.5 bits, see alignment E=4.8e-33 amino acids 293 to 455 (163 residues), 40.8 bits, see alignment E=1.4e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5800)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGG4 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BPHYT_RS28755 3-(2-hydroxyphenyl) propionic acid transporter (Burkholderia phytofirmans PsJN)
MNRSTPAEPNRLRQSKTAAASGWIGSALEYYDFLIYATAASLVFPQLFFPSGNPTVAIIA
SLATFGVGYVARPLGAMVLGHVGDRHGRKTVLIFCMFLMGISTMCVGLLPTYRQVGIWAP
VLLVILRLVQGFAVAGELSGASSMILEHAPFGRRGYFASFTIQGSQAGQLLAFGVFLPLA
HFMPKDQFASWGWRIPFLFSVVVIIVGYIIRRQVHETPTFAKERAQGQVPASPVAEVLRQ
NWGDVLRVVCMALTAVVVFLATVFGTAYAVQPAYGIGFPAGVYLWIPVLGNVCSVILIPF
VGSLSDRIGRRPPVLVGVLSAGLLSFGFLYAISIHSLWLSLIFSTLMWGIAYQGFNGVFP
SLFPELFRPRVRVTGMAIGQNVGTTLSALIPALFVAVAPPGSTHIPLKIGFLTFGICLIA
AFAAFTTRETYRIRLDELGDRNAIPVPTAEYERLRSESMVATSTNAAESGFVHNVRS