Protein Info for BPHYT_RS28710 in Burkholderia phytofirmans PsJN

Annotation: 3-(2-hydroxyphenyl) propionic acid transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 376 to 398 (23 residues), see Phobius details amino acids 405 to 426 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 388 (366 residues), 100.4 bits, see alignment E=1.1e-32 PF00083: Sugar_tr" amino acids 24 to 237 (214 residues), 81.3 bits, see alignment E=7.1e-27 amino acids 298 to 427 (130 residues), 25.3 bits, see alignment E=7.2e-10

Best Hits

Swiss-Prot: 33% identical to SHIA_ECOLI: Shikimate transporter (shiA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5790)

MetaCyc: 33% identical to shikimate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-27

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGF5 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BPHYT_RS28710 3-(2-hydroxyphenyl) propionic acid transporter (Burkholderia phytofirmans PsJN)
MSGSTQIEAHRQRQSKIAAASGWIGSALEYYDFFIYATAASLLFPQLFFPSQNPTVAIIA
SLATFGVGYVARPIGAMVLGHVGDRHGRKTVLIFCMFLMGMSTMGVGLLPTYHQVGIWAP
LLLVILRLIQGFAVAGEVSGASSMILEHAPFGRRGYFASFTLQGVQAGQLLAAAVFLPLA
HFLPKDQFASWGWRIPFLLSFVVIIMGYIIRRQVEETPAFREEQAHGEVPSSPVVEVLRQ
SWDDVLRVVCMALVAVIALLATVFGAAYAVQPAYGIGFPVGVFLWIPVLGNICSVILIPI
VGNLSDKIGRRPPVLAGVLSAGLLSFGYLYAISIHNLWLTIILSVLMWGIAYQGFNGVFP
SLFPELFRTRVRVTGMAIGQNVGTTLAALTPTLFVAVAPPGTANIPLKIGFLTFGICLIA
AFAAFTTRETYRIRLNDLGDRGAVPVPKAEYERLRGEAMAGRTRTADAQDLAKQLRS