Protein Info for BPHYT_RS28640 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF02518: HATPase_c" amino acids 38 to 135 (98 residues), 35.6 bits, see alignment E=2.8e-12 amino acids 305 to 415 (111 residues), 76.4 bits, see alignment E=6.1e-25 PF00512: HisKA" amino acids 195 to 258 (64 residues), 60.6 bits, see alignment E=3.1e-20 PF20161: VpsR" amino acids 433 to 548 (116 residues), 24.8 bits, see alignment E=3.8e-09 PF00072: Response_reg" amino acids 438 to 546 (109 residues), 67.6 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5775)

Predicted SEED Role

"Putative SigmaB asociated two-component system sensor protein" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGE2 at UniProt or InterPro

Protein Sequence (554 amino acids)

>BPHYT_RS28640 ATPase (Burkholderia phytofirmans PsJN)
MRHRILSTPISSNLSLVAIRDRSRQVGELFGLDNVQRTRFITAISEIARNAIRFAGGGTL
TFLVGDATDAEGLQCVVAQISDNGPGIVNLDELLRESREREAGVGLGIPGSRRMTDCFFI
HTEPGKGTTVTLEMFLPRATVRMSGREVSARAEQLTRRKPQTPVDELEQQNREMMQTLEE
LRRKSVELEDADARKNEFLAMLAHELRNPLAAISLSLQLAQQSGKEAHEKTYAVIGRQTA
QLSRMVNDLLDVSRITRGKVELQTEVVSISALIDGGIEMSLPELNRRGHKVAVERALEPI
FVRVDAARLKQVFNNIIHNAARYTLQPDTIKILVMREGNEVQIAITDRGVGIDSNLLPRV
FDLFAQAPTSIGRQDAGLGIGLTVVERLVRDHGGSVAAFSEGAGAGTRIVVTLPIVDEQA
PEGDTSSQHVVLTAEHKVLVVDDNKDSADALAALLELQGFECAVAYDGASALTLTDTFVP
TVGVIDLGLPDMSGFDVAVALRKKHGDAALTLVALSGYSSDDYRSDAVEAGFNDYFAKPL
VMDDFLNFLTTVGP