Protein Info for BPHYT_RS28560 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 121 to 139 (19 residues), see Phobius details amino acids 180 to 196 (17 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 39 to 316 (278 residues), 108.3 bits, see alignment E=1.9e-35

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_5757)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGC7 at UniProt or InterPro

Protein Sequence (356 amino acids)

>BPHYT_RS28560 ABC transporter permease (Burkholderia phytofirmans PsJN)
MTQMKQPSTSAVTRALHTVPWLVALCLPLVVDANTSGNLAYCLLWAFSALGLAAMWGYGG
ILSFGQTAFFGLSGYTYGIFTLNYGDTWFESWLGLGAGIVVSIVAAGLIGYMVFYGRIKG
VFIGIVTLSVTLVLETFMSQTAGPQWAIGEARLNGYNGMGGMPQLTIPWPGGPLTLENVS
FYYLVLLLLIAVYAIMRKLLDGTFGLTLIAIRENPQRAEMLGVDIRRHQLMVFVLGCTLG
GLSGALYTIWGSYITPSTMGLTAAAMPVIWVATSGRKSIGGTIIGTAFLVWLSQNLAVYG
SQYALILLGAILLIVVLAAPEGLLPFVARHLRRLSSRTSGASRHAGGCLKREEGKS