Protein Info for BPHYT_RS28515 in Burkholderia phytofirmans PsJN

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF03786: UxuA" amino acids 1 to 341 (341 residues), 496.1 bits, see alignment E=2.3e-153 TIGR00695: mannonate dehydratase" amino acids 142 to 342 (201 residues), 210 bits, see alignment E=3.1e-66

Best Hits

Swiss-Prot: 100% identical to UXUA_PARPJ: Mannonate dehydratase (uxuA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 100% identity to bpy:Bphyt_5748)

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGB8 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BPHYT_RS28515 mannonate dehydratase (Burkholderia phytofirmans PsJN)
MTFRWYGDTDPVPLAYIRQIPGMVGVVSAIYDVPVGEVWPIDRIRSLKEKIEAHGLTLEV
IESVPVHEDIKLGKPTRDTLIVNYGQTLRNLGACGVKVVCYNFMPVFDWTRTSLEMPLPD
GSTTLAFDTQAIRELDVSEGIQLPGWDASYRPEQLKALLRDYEALDEAGLWANLDYFLRA
IIPVAKEAGIKMAIHPDDPPRPIFGLPRIVKNRADLQRVLDIVDDPANGLTLCSGSLGAD
LQNDIPALVREFGARGRIHFAHLRNVQTNAAGDFHETSHRSADGSLDMAEIVKAYFETGF
EGYARPDHGRMIWGETGRAGYGLFDRALGAVYLNGIWEGLAKHPADHAAE