Protein Info for BPHYT_RS28505 in Burkholderia phytofirmans PsJN

Annotation: 5-deoxyglucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 5 to 263 (259 residues), 368.4 bits, E=9.6e-115
• TIGR04378: 5-deoxy-glucuronate isomerase
  • amino acids 19 to 263 (245 residues), 337.1 bits, E=3.2e-105

Best Hits

Swiss-Prot: 49% identical to IOLB_BACVZ: 5-deoxy-glucuronate isomerase (iolB) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 100% identity to bpy:Bphyt_5746)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

See B2TGB6 at UniProt or InterPro

Protein Sequence (276 amino acids)

>BPHYT_RS28505 5-deoxyglucuronate isomerase (Burkholderia phytofirmans PsJN)
MSDLLVKPSKHAKDGQIIHITPASAGWKYVGFDVFDLVPGATVTRDTGDREVVVVLVKGH
ATVGCEGLASREIGTRMSPFDGAPWSVYVPPHTRYTIVATDDVELGVCSAPAKGGLPPRF
IAPDEVKQETRGAGANLRHVRHILPETEPAESLLVVESVTPAGNWSSYPPHRHDTDDGEQ
QTYLEETYYHRVSPPQGFAIQRVYTDDRSLDETLAAYDKHVVLVPRGYHPVAAAHGYDLY
YLNVMAGPRRTWHVHNEPAHEWLLQSGASVAADGAR