Protein Info for BPHYT_RS28490 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 149 (28 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 230 (206 residues), 90.6 bits, see alignment E=1.1e-29 amino acids 234 to 435 (202 residues), 30.1 bits, see alignment E=2.5e-11 PF07690: MFS_1" amino acids 60 to 377 (318 residues), 94.2 bits, see alignment E=7.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5743)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGB3 at UniProt or InterPro

Protein Sequence (461 amino acids)

>BPHYT_RS28490 MFS transporter (Burkholderia phytofirmans PsJN)
MNTSPVSSGNAPVISRSAVNRVLAASVVGTAIEWYDFFLYATASALVFAKLFFPSFDPVV
GTIAAFGSFAVGYVARPFGAVFFGHFGDRIGRKATLVATLTIMGVSTFVIGLLPTYASIG
VWAPILLVAMRFMQGLGVGGEWGGAVLMVVETAPARKRGFFGAFPQLGVPLGLMLSTAVF
KAVSSMPSDAFYSWGWRLPFLLSVALIAIGLFIRLRVMESPVFEQIKASKQVVKAPLVEL
LRRHPKDLVLTIGTRFAVDITFNVINVFVLVYGTTRLGLSRGLLLNAIIVGCAFALITLP
LFGKLSDVIGRRTVFMLGAVFVAIYGFAFFPLLETRNPTLIFVAYVCGIALSQASVYGVQ
STWFAELFGTRVRYTGASLPYQIAGIITSGPTPLIATYLFATYGQTLPISIYIAATGLLS
LVCAFFLAETFRRDLSAEPEDEAAAAPGARASAHSPHPLTR