Protein Info for BPHYT_RS28480 in Burkholderia phytofirmans PsJN

Annotation: hydroxyglutarate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF01266: DAO" amino acids 4 to 393 (390 residues), 227.7 bits, see alignment E=3.1e-71

Best Hits

Swiss-Prot: 54% identical to LHGD_ECOLI: L-2-hydroxyglutarate dehydrogenase (lhgD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5741)

MetaCyc: 58% identical to (S)-2-hydroxyglutarate oxidase (Pseudomonas putida KT2440)
1.1.3.M4 [EC: 1.1.3.M4]

Predicted SEED Role

"L-2-hydroxyglutarate oxidase (EC 1.1.3.15)" (EC 1.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.3.15

Use Curated BLAST to search for 1.1.3.15 or 1.1.3.M4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGB1 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BPHYT_RS28480 hydroxyglutarate oxidase (Burkholderia phytofirmans PsJN)
MTYDFCIIGGGIVGLATAMELLQREPTASLLLLEKETTLAKHQTGHNSGVIHAGIYYQPG
SLKAELCKRGAEATKQFCTEHAIPFDVCGKLLVASNPLELSRMEALYARSQQNGLRVERL
DAAELQRREPNIVGLGGLFLDATGIVDYRQVCEAMARVIEKAGGEIRLGTQVTSIAEVGD
YVTVGASDEQQWRAKKLVVCGGLQSDRLARLAGVKIDHQIVPFRGEYYRLPASKNDVVRH
LIYPIPDPDLPFLGVHLTRMIDGSVTVGPNAVLGFGRENYPKFSVNLRDVAEYAAFPGFW
KTIWRNLGSGMGEMKNSLFKRGYLEQCRKYCPSLTVDDLLPYEAGIRAQAVMRDGTLVHD
FLFADTPRMVHVCNAPSPAATSAMPIGSMIADRILKAA