Protein Info for BPHYT_RS28415 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 70 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details PF01062: Bestrophin" amino acids 1 to 282 (282 residues), 288.9 bits, see alignment E=2.3e-90

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 100% identity to bpy:Bphyt_5726)

Predicted SEED Role

"probable membrane protein STY1534"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFQ8 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BPHYT_RS28415 hypothetical protein (Burkholderia phytofirmans PsJN)
MIVRPSENWFRLLFVWNGSVLQSIIPQLLFMAAVSTLAVFTQGRIFGEKIPLNTAPFTLF
GLALAIFLAFRNNASYGRFNEARHLWGSLLISTRALTSQVLCYVPEQANKFQLAQTTIAF
IYALKHQLRNTDPMPDLVRLLGRDQAELLRAKQYKPTALLNDIRRELAQTERHPQVGETK
LWMLDAQINELGAAVGGCERIASTPIPFSYSVLLHRTVYAYCVMLPFGLVDSTEFFTPLL
CVFISYTLLALEAIASEVAEPFTTAPNALALDAMSRNIERSILELCGRPLPEAVAPIRLY
HLT