Protein Info for BPHYT_RS28350 in Burkholderia phytofirmans PsJN

Annotation: fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 25 to 43 (19 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details PF00487: FA_desaturase" amino acids 51 to 283 (233 residues), 109.7 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5711)

Predicted SEED Role

"Fatty acid desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFP9 at UniProt or InterPro

Protein Sequence (316 amino acids)

>BPHYT_RS28350 fatty acid desaturase (Burkholderia phytofirmans PsJN)
MAIYLDDTQRNALARMATSWTWRTQWPTWVLIVTIYGGWFGVATHARVLGLPFTTLLLAV
LGTWYMSLQHELLHGHPTRSPFVNAVFGFAPLAVWFPYGIYRDSHLQHHDDPHLTHSERD
PESYFVSALVWRRTGWAIRALLTFRNTFIGRLLVGPAFSIAATSVDALRKIKSGDWQDVP
LWLAHLAAVAGLAVWMQLACGIPAWVFIVGAGYGALSLSSIRSFQEHREAQAHEHRSVIN
EAAWFWRLLFLNNNYHLVHHDLPHVPWFALRAVYERSRQQYIERSGGFLVTGYGEWLMSY
AFATVVHPVANVGPEY