Protein Info for BPHYT_RS28210 in Burkholderia phytofirmans PsJN

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 292 to 292 (1 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 324 to 342 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 65 to 330 (266 residues), 119.3 bits, see alignment E=8.5e-39

Best Hits

KEGG orthology group: K10556, AI-2 transport system permease protein (inferred from 100% identity to bpy:Bphyt_5683)

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 2" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFM1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>BPHYT_RS28210 ATPase (Burkholderia phytofirmans PsJN)
MMRHSSTHAAPVQAPVPKRAASSPGGFAASIAKSRETTLFVVLVLLIVGTGLAKPQFLNL
QNLRDVLLNVSIISLLTAGMTVVILMRHIDLSVGSTVGISAYAVGSLYVAFPHMPVIVAL
AAGLAIGLVAGTINALLVGVGRVPSLVATLSTLYIFRGADYAWVHGGQINATSLPDAFSR
LATGTLLGIPTLALIAVVVLIGLAVYLKQFRGGREHYAIGSNPEAARLAGVNVERRVMAG
FLLSGAIAGFAGALWLARFGTVDASTAKGIELQVVAAAVVGSVAITGGVGTILGATLGAL
VLGVISIALVVLHVSPFWEQAIEGALIVAAITADTLLARSVAKRMMRKRDHG