Protein Info for BPHYT_RS28180 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 129 to 155 (27 residues), see Phobius details amino acids 171 to 194 (24 residues), see Phobius details amino acids 229 to 253 (25 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 360 to 376 (17 residues), see Phobius details amino acids 387 to 412 (26 residues), see Phobius details amino acids 429 to 451 (23 residues), see Phobius details amino acids 461 to 483 (23 residues), see Phobius details amino acids 508 to 528 (21 residues), see Phobius details amino acids 535 to 556 (22 residues), see Phobius details amino acids 562 to 584 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 304 (199 residues), 42.8 bits, see alignment E=2.4e-15 amino acids 411 to 558 (148 residues), 40 bits, see alignment E=1.8e-14

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to bpy:Bphyt_5677)

Predicted SEED Role

"ABC Fe3+ siderophore transporter, inner membrane subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFL5 at UniProt or InterPro

Protein Sequence (589 amino acids)

>BPHYT_RS28180 ABC transporter permease (Burkholderia phytofirmans PsJN)
MPSTSATGHRAALSRAANGRSSEAIPRGALQPFMGLLRWLVIAVLTVAVALPLGFILLQS
VLNAPFFDAKRSFGLTGFEFIFSDPDFGSALKNSFVIAAGMLFISIPLGGILAFLMVRTD
LPGRRWLEPLLLTPVFVSPMVLAFGYVVAAGPVGFYSVWWMELFGTAQVPWTVYSVFAIT
VIVGLTHVPHVYLYSSAALRNLSSDVEEAARVAGARPFRVALDVSLPMTLPALLFAGVLV
FFLGFEVFGLPLVLGDPEGHLVLATYLYKLTNKLGVPSYHLMAAVAMCIVAITFPLVLLQ
RRLLKSANRFVTVKGKAGRQTVLPLGAWRWVALAIVALWLLLTVFVPISGITLRAFVTHW
GQGAPLAEVLTLANFTELFEQDNLVRAILNTLGIGVIGGALAVGFYSLVAFAGHRRNDWA
TRLLDYLVLLPRAVPGLLAGLAFLWIFLFVPGLKELKNSMWSIWIAYTVVWLAYGMRLIQ
SALLQVGPELEEAGRSVGGTRARVSLDVTLPLVRFGLLAAWLLIFMIFEREYSTGVYLLS
PGTEVIGALLVSLWATGAVDQVAALSVINIAMVGAGLGVALRFGVKLHG