Protein Info for BPHYT_RS28145 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 67 to 85 (19 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 220 to 382 (163 residues), 117.6 bits, see alignment E=2.3e-38 PF00990: GGDEF" amino acids 222 to 379 (158 residues), 121.7 bits, see alignment E=1.3e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5670)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFK9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>BPHYT_RS28145 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MHVDLLTLYLLIVGTLLASCAMTLWEHRTHPRRSRELRILAAGYATLAVGCAAALFRRDL
PGAMGSGLSNFVIVGGYLLILRGVAILNGRKYDAGSIAMLVLVALTWAVCGARWQNVLWN
YVSAIPIAVASCLTSRELLRSDGMKSLKSRHIAVMVSGGHGLFYAARAFVLPWLGTLYGQ
GLLSVASKITMYEGVLYSVILPMTLLTLIREETHGRLLQESQTDYLTGLGNRRWFFEEGA
RVMREAGVSRPVSLLAFDLDHFKRINDRYGHETGDAVLKSFAAITRSLTGPEAMLARIGG
EEFAALLPGHDSLRAEEVGDAIVRRFAGTVLHRINDVDIRATVSVGLAQQSASEAPTLAD
LLASADQALYRAKSLGGNRLELARTGVRGTATC