Protein Info for BPHYT_RS28050 in Burkholderia phytofirmans PsJN

Annotation: serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 signal peptide" amino acids 1 to 53 (53 residues), see Phobius details transmembrane" amino acids 322 to 344 (23 residues), see Phobius details amino acids 351 to 369 (19 residues), see Phobius details amino acids 375 to 392 (18 residues), see Phobius details amino acids 399 to 418 (20 residues), see Phobius details amino acids 425 to 447 (23 residues), see Phobius details PF01957: NfeD" amino acids 435 to 527 (93 residues), 48.3 bits, see alignment E=5.8e-17

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 100% identity to bpy:Bphyt_5652)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFJ1 at UniProt or InterPro

Protein Sequence (537 amino acids)

>BPHYT_RS28050 serine protease (Burkholderia phytofirmans PsJN)
MSTYPRLPFRQSGSRMSPIRGDMAGRLMRGMTVLGMLLAFGFASCESNVALRAAVAPNSV
VVIPVNGAISPASADFIVRSLQRAAEDRAQLAVLQLDTPGGLDTSMRQIIKAILGSPVPV
ATFIAPSGARAASAGTYIVYASHIAAMAPGTNLGAATPIQMGIGGAEPPGGGGTPGLPGV
GGGGTGGGGHAGGAGNDAGDTGAGNPSKPAASAPTGPASALPLDTQSTEMRKQVHDAAAY
IRGLAQMRGRNADWAERAVREAVSLSAADALAQHVVDLNARDVPDLLRQVDGRTLVTSAG
NVKLDTANARIVTLEADWRSHFLAVITDPNVALILLMIGMYGLFFEFANPGFVLPGVVGA
ISLLLGLFAMQMMPINYVGLGLIFLGIAFLIGEAFLPTFGSLGFGGVVAFVIGALMLIDT
DVPGYGIPLPMIAAVTVFSVVFVLGVSRLALSARRRPVVTGSEAMIGSVGVVLDGGLSPA
DLTADGALAGWAQVHGERWRVSSTAPVAAGHAVRVTARRGLTLTVVPTEARQQGEGS