Protein Info for BPHYT_RS27970 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 181 to 199 (19 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 127 to 310 (184 residues), 71.9 bits, see alignment E=2.9e-24

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_5636)

Predicted SEED Role

"Dihydroxyacetone ABC transport system, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TFH5 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BPHYT_RS27970 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MRPTATQHSVVASSPRGKRFAAAVVITYALLATLPMVWIFLTSFKTQEDAIAYPPVVLFQ
PSMEGYVNLFTIRSRQTPEFIASLPPARTWYERDVRKRNMVIAGPSKVLPRFANSLVIGF
GSTFLAVFLGTLAAYAFSRFKVPLADDLLFFILSTRMMPPIAVAIPIYLMYRALGLSDSC
VGMIVLYTAVNVSLAVWLLKGFMDEIPREYEEAALVDGYTRLQAFVKVVLPQAITGIAAT
AIFCLIFAWNEYAFASLLTSGDAQTMPPFIPFIIGEGGQDWPAVAAATTLFVLPILIFTV
VLRKHLLRGITFGAVRK