Protein Info for BPHYT_RS27915 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 34 to 51 (18 residues), see Phobius details amino acids 57 to 83 (27 residues), see Phobius details amino acids 93 to 117 (25 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 165 to 181 (17 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 282 to 300 (19 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 337 to 361 (25 residues), see Phobius details amino acids 372 to 395 (24 residues), see Phobius details amino acids 408 to 425 (18 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 236 (212 residues), 87.9 bits, see alignment E=7.1e-29 amino acids 231 to 416 (186 residues), 41.2 bits, see alignment E=1e-14 PF07690: MFS_1" amino acids 27 to 385 (359 residues), 97.2 bits, see alignment E=9.7e-32 amino acids 297 to 431 (135 residues), 33.4 bits, see alignment E=2.4e-12

Best Hits

Swiss-Prot: 70% identical to CITA_ECOLX: Citrate-proton symporter (citA) from Escherichia coli

KEGG orthology group: K03288, MFS transporter, MHS family, citrate/tricarballylate:H+ symporter (inferred from 100% identity to bpy:Bphyt_5624)

MetaCyc: 69% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"TcuC: integral membrane protein used to transport tricarballylate across the cell membrane" in subsystem Tricarballylate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG95 at UniProt or InterPro

Protein Sequence (439 amino acids)

>BPHYT_RS27915 major facilitator transporter (Burkholderia phytofirmans PsJN)
MNPTEPIAATSSVSRSTRAAAVLRVTSGNFLEQFDFFLFGFYATFISKIFFPSTSEFASL
MLTFAVFGAGFLMRPLGAIFLGAYIDKVGRRMGLIVTLSIMASGTVLIACVPGYASIGLL
APALVLLGRLLQGFSAGAELGGVSVYLAEMATPGNRGFYTSWQSASQQVAIVMAAAIGYG
LNEWLSAQQIGAWGWRVPFLIGCAIVPFLFMLRRSLQETAAFEARQHHPQAREIFSMLLA
NWRIVIGGMLLTAMTTTTFYLITVYTPTFGRSVLKLSTADSLMVTLLVAVSNFVWLPIGG
AVSDRIGRKPLLLAVSVLAIFTAYPALSWLADAPSFARMLIVLLWFSFFFGMYNGAMVAA
LTEVMPAEVRVAGFSLAFSLATAVFGGFTPAVSTYLIQVTHDKAAPGYWLSFAALCGLCA
TLGLYRRRASSSASAASSA