Protein Info for BPHYT_RS27905 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 29 to 232 (204 residues), 99.2 bits, see alignment E=2.7e-32 amino acids 242 to 420 (179 residues), 34.8 bits, see alignment E=9.6e-13 PF07690: MFS_1" amino acids 45 to 285 (241 residues), 69.5 bits, see alignment E=2.6e-23 amino acids 258 to 426 (169 residues), 41.1 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to bpy:Bphyt_5622)

Predicted SEED Role

"Dicarboxylate MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG93 at UniProt or InterPro

Protein Sequence (435 amino acids)

>BPHYT_RS27905 MFS transporter (Burkholderia phytofirmans PsJN)
MHETTPAELDAATRPLRRRSALRSIAGGSIGNLIEWYDFHVYTTFSIFFAASFFPRENRT
IQLLSTAAIFAIGFLLRPVGSWLIGLYADRRGRRSALTLSVILMCAGSLAIGLCPTYPQI
GMAAPLVLLLARLVQGFSLGGEYGASSVYLSEIARPGHRGFYSSFHYVTLILGQLLATLV
QVVLQALIPRAELIDWGWRVPFITGAALALVAWWVRRNIDETPDFRALDEKDKRGVSLSA
LREHWRPVLLVFGLTTGGTLAFFTYTVYMHNYLVNTVGLSAQTSAWLSLSTLTLFMVVQP
FFGALSDRIGRRPLLLWFGIGGTFGTWPLLTALAHTHSATTAFLLLALALMIVSGYTSVC
SVMKAQLFPARLRALGVGVPYAIATAVFGGTASYAGLWFKSIGHESGFYLYASACIGCTL
IATLSLRSSDMKMES