Protein Info for BPHYT_RS27840 in Burkholderia phytofirmans PsJN

Annotation: GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13200: DUF4015" amino acids 99 to 411 (313 residues), 360.7 bits, see alignment E=3e-112

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5606)

Predicted SEED Role

"COG1306 predicted glycoside hydrolase" in subsystem Predicted carbohydrate hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG82 at UniProt or InterPro

Protein Sequence (418 amino acids)

>BPHYT_RS27840 GTP-binding protein (Burkholderia phytofirmans PsJN)
MRTLPFLRHVAVALTILSTGVTAGAATGIVIDAATAKPVAHALVTTTAGVQQADVDGQFE
FDSSVSSVGARAPGYLRTQADVTGETPLTLKLTPFRPKAVYLSVYGVASPTLREEALALT
QTTPINALVIDVKGDRGLTPYHSAARDAAGASARLPRREPLVRDFPALLAEFHRRHLYLI
ARIVVFKDDPLADAHPAWTVRDAGGQPWRDREHLQWLDPFSREVWQHNLDVAEEAAKMGF
DEIQFDYVRFPDASGLHFSQANTRVNRTAAIVGFLQAARARLAPYNVFVAADIFGYVCWN
LDDTAIGQQIELLGAPLDYISPMLYPSGFTWGLPGCTNPVTDPGQIVRRSLAEAVRRTHL
PGVRFRPWLQAFRDYAFDHREFDAAQIRAQTAAADAVGSDGWMLWNPRNRYDPADLPQ