Protein Info for BPHYT_RS27815 in Burkholderia phytofirmans PsJN

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 582 transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 190 to 212 (23 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 272 to 294 (23 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 401 to 431 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 36 to 405 (370 residues), 279.1 bits, see alignment E=4.9e-87 PF01740: STAS" amino acids 458 to 567 (110 residues), 54.4 bits, see alignment E=9.3e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5601)

Predicted SEED Role

"Sulfate transporter/antisigma-factor antagonist STAS:Sulphate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG77 at UniProt or InterPro

Protein Sequence (582 amino acids)

>BPHYT_RS27815 transporter (Burkholderia phytofirmans PsJN)
MNRLPLSPRDPGSLSPGVWRWIPALATLRTYQRGWFVKDLFAGVVLTAVLVPTGLSFAQA
AGLPGVGGLYASIAALLAYAIFGPSRILVLGPDSALTALIAAAIVPLAGGRPDSALALAG
MLAILSGICCALIGLLRLSFVSDLLSKPIQYGYLNGIALTLFAGQFPRLLGFAVPGGTFL
DEATSVFQGVVAGQTSPVACVIGVSCLGAIVLLKRYAAALPGTLIAVAAATVAVWLLELD
LHAGIAVVGRLPEGLAAVRLPAVSLHDVRELSGAAIAIALVSFADMSVLSRAFALRGAYK
VDRDQELVALGIANIAAGLLQGVPVCSSASRTPVAEAAGAKTQLTCVVSALCIAFLLIAA
PALLKHVPNAALAAVIVSAALSLFDLANVTRLYRMRRSEFALSMVCFAGVLTVGVVQGIF
IAIGLSLLSFVWRAWHPYDAVLGKIEGRPGYHDVARHPDAKQLAGLLLIRWDAPLFFANA
EIFSQHVRRAIAQAAPRPEWLVVASEPITDIDVTAADMLSRLDHELEATGIAMYFAEMKG
PVKDRLRAYGLSEIFDERHFFETVTDAVRTYTAQHCVEGPGE