Protein Info for BPHYT_RS27805 in Burkholderia phytofirmans PsJN

Annotation: RNA-metabolising metallo-beta-lactamase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00753: Lactamase_B" amino acids 17 to 202 (186 residues), 44.7 bits, see alignment E=3.9e-15 PF16661: Lactamase_B_6" amino acids 18 to 166 (149 residues), 30.5 bits, see alignment E=5.6e-11 PF12706: Lactamase_B_2" amino acids 25 to 213 (189 residues), 44.4 bits, see alignment E=3.9e-15 PF10996: Beta-Casp" amino acids 247 to 366 (120 residues), 126.1 bits, see alignment E=2.7e-40 PF07521: RMMBL" amino acids 380 to 443 (64 residues), 65.6 bits, see alignment E=8.2e-22

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 100% identity to bpy:Bphyt_5599)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG75 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BPHYT_RS27805 RNA-metabolising metallo-beta-lactamase (Burkholderia phytofirmans PsJN)
MKLTFLGGAETVTGSKYLVEASGMRILIDCGLFQGTKNLRLRNWSPLPVPVDTLDAVILT
HAHIDHTGYLPVLARDGYRGPVYCTPGTAALCDIMLRDSAHLQEEEADFANRHGFSKHKP
ALPLYTLDDAQRALRLIVQREFDVPTPLNDELCFRFLPAGHILGAASVVLCWRHTVLAFS
GDLGRPGNPIMRAPMKLAHADYLVVESTYGDRLHAATDPEEELAELFARTFARGGVVVMP
CFAVGRAQEILYYIAHLKQTGRMANVPVYLDSPMATGVTEVYRHHLNEHRLTVSQAAMID
KAAIMVRTVDQSKAIASHHGPMVIIAGSGMATGGRVLHHLRLYAPDPRNTIALVGYQAAG
TRGAAIAAHEPTIKIHGEYVRIRAHVETISSLSAHADYSETLNWLSAMSPAPTQTYITHG
EPAAADALRRRIADTLGWPCTVPVYQQTVELAE