Protein Info for BPHYT_RS27790 in Burkholderia phytofirmans PsJN

Annotation: poly-beta-hydroxybutyrate polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 351 to 369 (19 residues), see Phobius details PF12551: PHBC_N" amino acids 57 to 96 (40 residues), 48.9 bits, see alignment 7.2e-17 PF07167: PhaC_N" amino acids 130 to 302 (173 residues), 172.2 bits, see alignment E=1.3e-54 PF00561: Abhydrolase_1" amino acids 276 to 543 (268 residues), 45.6 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to bpy:Bphyt_5596)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG72 at UniProt or InterPro

Protein Sequence (618 amino acids)

>BPHYT_RS27790 poly-beta-hydroxybutyrate polymerase (Burkholderia phytofirmans PsJN)
MSTRANHNVSEDHSADLPNALHASKRHRRPTAVLSGGDHQSVARAGRNAAVPTLWRNELD
LAAHAAVAALTGGLSPASTMLAGLDWALHIAVSAGKGFDLARQYASACCEWAKGMQLAGS
VDSRADRAQQDPRFSDASWKRWPYWLYRDGFLQAQQWWEAATTAIPGVERHHEELVRFFA
RQWLDACSPSNCIATNPAVQTAASRSGGLNFAVGMQHWLEDLREFAGVPEDDRASRSHAW
LPGREVAITAGKVVWRNALCELIQYAPATTTVAREPLLIVPSWIMKYYILDLQPHNSLIR
YLVDAGYTVYAISWRNPPEAFRDVGLGDYLQDGLFAALAQVRLRHAQPVHAVGYCLGGTL
LAMAAAALFRDERGNELKTVTLLAAQTDFTEPGELGLFIDASELAELDALMWRQGYLDGR
QMSSAFQLLNARDLIWSRMMSEYLLGRRSKPNDLMAWNADTTRLPYRMHSEYLTSLFLNN
DLAEGRYCVDGRPVALSDIEAPMFVVGTERDHVSPWRSVYELHLLTHNPLTFLLTAGGHN
AGIVSEPGHGGRYYRCATRPGGAPYRSRDDFLAQTTPVDGSWWLCWNRWLRERSSGDVAP
RAIDDGLCDAPGIYVFEK