Protein Info for BPHYT_RS27785 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 93 to 113 (21 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details amino acids 145 to 145 (1 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 4 to 181 (178 residues), 136.2 bits, see alignment E=5.9e-44

Best Hits

KEGG orthology group: K07034, (no description) (inferred from 100% identity to bpy:Bphyt_5595)

Predicted SEED Role

"Transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG71 at UniProt or InterPro

Protein Sequence (201 amino acids)

>BPHYT_RS27785 hypothetical protein (Burkholderia phytofirmans PsJN)
MNIKAPNPASLGLAGFALTTWLLSMINAGWFNGESMGMVLAVAFAYGGTAQMIAGLMEIP
RGNAFGATAFLSYGAFWWSLALFVLFLHGNVPAAFIGWYLFLWGMFTLYMWVATWRAARA
LQLVFLSLWLTFFVLAASEWTGLAWLHHAGGYLGLVTALLAFYLSAAEIINETHGRVVLP
VGAASPRIEVALTVDEELRRA