Protein Info for BPHYT_RS27655 in Burkholderia phytofirmans PsJN

Annotation: potassium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details PF00520: Ion_trans" amino acids 75 to 229 (155 residues), 40.1 bits, see alignment E=2.6e-14 PF07885: Ion_trans_2" amino acids 152 to 224 (73 residues), 45.8 bits, see alignment E=4.7e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5570)

Predicted SEED Role

"Kef-type K+ transport systems, predicted NAD-binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG47 at UniProt or InterPro

Protein Sequence (277 amino acids)

>BPHYT_RS27655 potassium transporter (Burkholderia phytofirmans PsJN)
MSDGFRVAGLGGVVLHDGARAVRAWRWLQWVLLGFSLLAIPAFYFELAAHSTALHQIGRA
LYAGMAAGFAVSLAWIARLCHEPRRFLMRNRYDVLVAVGAAVSVMSGLSAWSPLEWAMRM
IFVGLVAARIVVSLRGFFSPNRLLLLLATAAVLLASAGAGFYWLEPGVHTYGEGVWLAFE
SSATVGYGDMAPTTPASRVFAAFVVLLGYGLLSLLFASIAAIFVEQEERVLRREMHRDIK
TLQAEIAALRTEVRRMGSAAHTDDSAVGRHRPPGEHE