Protein Info for BPHYT_RS27615 in Burkholderia phytofirmans PsJN

Annotation: F0F1 ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR01039: ATP synthase F1, beta subunit" amino acids 18 to 475 (458 residues), 608.6 bits, see alignment E=3.7e-187 PF02874: ATP-synt_ab_N" amino acids 21 to 89 (69 residues), 36.6 bits, see alignment E=5.4e-13 PF00006: ATP-synt_ab" amino acids 147 to 360 (214 residues), 243.3 bits, see alignment E=2.2e-76

Best Hits

Swiss-Prot: 88% identical to ATPB1_PARXL: ATP synthase subunit beta 1 (atpD1) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 100% identity to bpy:Bphyt_5560)

MetaCyc: 52% identical to ATP synthase F1, beta subunit (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TG40 at UniProt or InterPro

Protein Sequence (492 amino acids)

>BPHYT_RS27615 F0F1 ATP synthase subunit beta (Burkholderia phytofirmans PsJN)
MSTQPPSIVPDSSSAASDGSVVAVRGAVVDVRFADSPLPSIDDALLILSDDLSPVLAEVQ
AHLSETTVRALALQATAGLRRGARVRTCGGPIATPVGEAVLGRLLDVTGSPRDDGAALSA
QLERRPIHRAAPPLAAQTGATSLFSTGIKVIDLLAPLAQGGKAAMFGGAGVGKTVLVMEL
IHAMVERYKGISVFAGVGERSREGHEMLLDMRTSGVLARTVLVYGQMNEPPGARWRVPFT
ALTIAEYFRDERRQNVLLLMDNVFRFVQAGAEVSGLLGRMPSRVGYQPTLASEVASLQER
IVSVGDVSVTAIEAVYVPADDFTDPAVTAIAAHIDSMVVLSRAMAAEGMYPAIDPIASSS
ILLDPLVVGEEHVAVATEVRRIIEHYRELQDVISLLGVEELGAEDRALVGRARRLQRFLT
QPFAVTQAFTGEAGRSVTVGETIAGCKAILAGECDNWRESSLYMIGSLDEARRKEQTAVA
QDAVTRGMETVR