Protein Info for BPHYT_RS27475 in Burkholderia phytofirmans PsJN

Annotation: glutaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03814: glutaminase A
  • amino acids 7 to 304 (298 residues), 408.8 bits, E=5.9e-127
• PF04960: Glutaminase
  • amino acids 21 to 304 (284 residues), 381.3 bits, E=1.4e-118

Best Hits

Swiss-Prot: 100% identical to GLSA_PARPJ: Glutaminase (glsA) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K01425, glutaminase [EC: 3.5.1.2] (inferred from 100% identity to bpy:Bphyt_5532)

Predicted SEED Role

"Glutaminase (EC 3.5.1.2)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.2)

MetaCyc Pathways

• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• D-Glutamine and D-glutamate metabolism
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.2

Sequence Analysis Tools

See B2TG13 at UniProt or InterPro

Protein Sequence (304 amino acids)

>BPHYT_RS27475 glutaminase (Burkholderia phytofirmans PsJN)
MNYASILEQIRGDLQPFLGTGKVADYIPELATVPADSFGMAIVTASGEIFRTGEADTRFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVQAETALVEFMRRLTGETSIDYDSRIAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVAPVTGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAACVWSPALDSNGNSAAGVLALEWLTTYTG
QSIF