Protein Info for BPHYT_RS27415 in Burkholderia phytofirmans PsJN

Annotation: major facilitator transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 119 to 144 (26 residues), see Phobius details amino acids 163 to 180 (18 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 234 to 258 (25 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 307 to 327 (21 residues), see Phobius details amino acids 335 to 358 (24 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 21 to 218 (198 residues), 81.7 bits, see alignment E=5.4e-27 amino acids 213 to 421 (209 residues), 43.7 bits, see alignment E=1.8e-15 PF07690: MFS_1" amino acids 24 to 381 (358 residues), 97.3 bits, see alignment E=8.8e-32

Best Hits

Swiss-Prot: 76% identical to CITH_KLEPN: Citrate-proton symporter (citH) from Klebsiella pneumoniae

KEGG orthology group: K03288, MFS transporter, MHS family, citrate/tricarballylate:H+ symporter (inferred from 100% identity to bpy:Bphyt_5520)

MetaCyc: 68% identical to propane-1,2,3-tricarboxylate-proton symporter (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-49

Predicted SEED Role

"metabolite/H symporter, major facilitator superfamily (MFS)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGM9 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BPHYT_RS27415 major facilitator transporter (Burkholderia phytofirmans PsJN)
MHPSPSTLTPARSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANVFFPAASEFASLMMTF
AVFGAGFLMRPLGAIVLGAYIDDVGRRKGLIVTLSIMATGTILIAFVPGYATIGLAAPAL
VLIGRLLQGFSAGAELGGVSVYLAEMATPGRKGLFTSWQSASQQVAIVVAAALGFALNQS
LDAATIAAWGWRVPFFVGCMIVPFIFMLRRNLQETEEFKARQHRPNMKEVLRTLVENWTV
VIAGMMLVAMTTASFYLITVYAPTFGKTVLHLSTADSLLVTLCVAVSNFVWLPIGGALSD
RIGRRPLLVAMTLLAILTAYPALSFLAHAPSFVNMLLALLWLSFMYGIYNGAMVVALTEV
MPAQVRVAGFSLAYSLATAVFGGFTPAISTALIHMTGDKAAPGYWMSFAAACALLATFAL
YRRRAATLTPAH