Protein Info for BPHYT_RS27385 in Burkholderia phytofirmans PsJN

Annotation: DeoR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 291 to 316 (26 residues), see Phobius details PF02743: dCache_1" amino acids 47 to 276 (230 residues), 55 bits, see alignment E=8.7e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 327 to 490 (164 residues), 170.8 bits, see alignment E=1e-54 PF00990: GGDEF" amino acids 331 to 488 (158 residues), 155.3 bits, see alignment E=1.2e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5514)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGM2 at UniProt or InterPro

Protein Sequence (493 amino acids)

>BPHYT_RS27385 DeoR family transcriptional regulator (Burkholderia phytofirmans PsJN)
MSVSISNGKLAVWAGRHSLIVGVLGTLMALAVTAISLATLQAARNQALDHAHDTSGNVTS
VLVSNIERTFETSDNALLTLIAAWQNPAVQSMDSADRHKIFFSSTSARYLTGAGVTDSSG
SLIDGCCANSHHWNFSDRDYFVVHRESPNAGLYLSSPYRARSRSGVEAIALSRRVNQPDG
SFGGVVMVAIDLAYFRQLLSKLDVGPHGVSAIVRTDGTVIARNPPLSTAQTIKSATFFSR
MVNHDSGFYAARSSIDGTVRLYTFQRIPGTPLIAVVAPAETDILAGSRRMAWMVGVSTAT
IGIAFCVVVWLLAFALREHVKTQVLLTELTQTDPLTGVRNRRALDEFLENEWERLRRNES
CLSVLFIDADHFKQYNDSYGHAQGDLALKHLAACIRRHACRRGDLTARYGGEEFVVVLPD
TDETGAMQVAEAIRHEVESGPIHLSESLARFTVSIGCATGRRAYPRSLAELTNKADSALY
AAKRGGRNAVVPG