Protein Info for BPHYT_RS27190 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 279 to 307 (29 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 332 (280 residues), 162.1 bits, see alignment E=7.6e-52

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to bpy:Bphyt_5472)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TGQ9 at UniProt or InterPro

Protein Sequence (343 amino acids)

>BPHYT_RS27190 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MLEITSGPNQALDRQVQQRRRDLIQKFAALGSLVVLIVAFSLTSAAFFSVGNLMTVALQV
TSIAYLGVAATCVIITGGIDLSVGSVLALAGVAAALLVKAGVPIPVAMLGGMLVGAACGW
VNGICVTRMGLPPFIATLGMMLVARGLALQITGARPVSGLGDAFGELGNGALFRISHIGA
DGFPDTVFPGIPYPVVIMVVLFAAVSILLSRTSLGRHIYAVGSNAEAARLSGVNVQGVKL
FTYVLSGLLAGATGCVLMSRLVTAQPNEGVMYELDAIASAVIGGTSLMGGVGTISGTAIG
AFVIGVLRNGLNMNGVSSFIQQIIIGVVILGTVWIDQLRNRKL