Protein Info for BPHYT_RS26970 in Burkholderia phytofirmans PsJN

Updated annotation (from data): L-lactate dehydrogenase, LldF subunit
Rationale: Specifically important for utilization of L-lactate and D,L-lactate as well as L-rhamnose and L-fucose, which are catabolized via L-lactate
Original annotation: 4Fe-4S ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 PF02589: LUD_dom" amino acids 67 to 282 (216 residues), 117.5 bits, see alignment E=1.3e-37 PF13183: Fer4_8" amino acids 304 to 369 (66 residues), 42.3 bits, see alignment E=1.7e-14 PF00037: Fer4" amino acids 305 to 318 (14 residues), 21.8 bits, see alignment (E = 2.5e-08)

Best Hits

Swiss-Prot: 40% identical to LUTB_MACCJ: Lactate utilization protein B (lutB) from Macrococcus caseolyticus (strain JCSC5402)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5428)

MetaCyc: 48% identical to L-lactate dehydrogenase iron-sulfur cluster-binding protein LldF (Shewanella oneidensis)
L-lactate dehydrogenase (cytochrome). [EC: 1.1.2.3]

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBY8 at UniProt or InterPro

Protein Sequence (464 amino acids)

>BPHYT_RS26970 L-lactate dehydrogenase, LldF subunit (Burkholderia phytofirmans PsJN)
MSNRIDHAKAAGAFIGKTEHVAFHDKRLWDLREKRDAQAHGIAEWETMRELASGIKEHTL
SNLSQYLEQFAAAAEANGVTVHWAATAEEHNALVHQIMSERGMTTLVKSKSMLTDECKMR
EYLEPRGITVMETDLGERIQQLDHQDPSHMVVPAVHKLRADVAELFGRTIGTDPKNSDIH
YLAESQRMNTRPYFVREKTAGMTGCNFAVAETGTVVVCTNEGNADLSANVPPLHIASIGI
EKLIPKVSDLGVFIRMLSRSALGSPITQYTSHFRAPRPGTEMHFILVDHGRSERLAMEDF
WYSLKCIRCGACMNTCPVYRRSGGLSYGGTYSGPIGAIINPTFDLKRYSALPFASTLNGS
CTNVCPVKINIHEQIYKWRTVIAERHEVPFVKQEVLKMAGRLLASPTLYRATVSSMGSAL
RRLPNFVLYNPLNIWGKQRELPEAPKLTFHAWYKKNRGDGNGNA