Protein Info for BPHYT_RS26940 in Burkholderia phytofirmans PsJN

Annotation: nuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 transmembrane" amino acids 475 to 493 (19 residues), see Phobius details PF21315: FAN1_HTH" amino acids 10 to 91 (82 residues), 121.5 bits, see alignment E=1.7e-39 PF18081: FANC_SAP" amino acids 96 to 157 (62 residues), 49.8 bits, see alignment E=4.9e-17 PF08774: VRR_NUC" amino acids 453 to 564 (112 residues), 123.1 bits, see alignment E=9.7e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5422)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBY2 at UniProt or InterPro

Protein Sequence (636 amino acids)

>BPHYT_RS26940 nuclease (Burkholderia phytofirmans PsJN)
MATTASPYALYYLLNFERALAWLAQRYDDLFDAREQEFLREFAALPRSSRALLVRMLMRK
GTLFRASRLSYDEIGCPVQAAAPIAALGWVDAQPRLTLDELFALTTRAGLMEIFADAIAM
IPGARSLRKPDLLETLRPFYAGESDEQDATARPLSAWHSRTDDRVFHVTIAPLCERLRLM
FFGNLQQEWSEFVLADLGVFQYEKVAFAPSSRAFQQRADVDVYLALHACREALECLPGDE
TEAVAVEEIVAAVAAIETGNPWLETRRAKLLFRIGCLCERRQNWAAALAVYERCAWPGAR
HRRMRVLERSERFDDAFALASQAAAAPESEEEAQRVARMLPRLQRKRGEPVARARAARPV
ERSMLVLPRPAAPTPVEYVARDHLTCEAAPVHYVENALINSLFGLLCWEPVFAALPGAFF
HPFQRGPADLHAPDFHARRAEQFAACLEQLDSGVYRETIVRHLHGKAGLQSPFVFWGLLT
PELVALALDCLPAAHLKLWFERLLRDVRGNRSGLPDLIRFWPAERRYELIEVKGPGDRLQ
DNQIRWLAYCAQHGMPVRVLDVRWADEAVVAEGGAAEDAAEVAVEAVSEATLETAINATI
DLAAEAATKATIEVATKPATKPATKTTITPTSEARA