Protein Info for BPHYT_RS26930 in Burkholderia phytofirmans PsJN

Annotation: mechanosensitive ion channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 889 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 155 to 177 (23 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 318 to 337 (20 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 427 to 451 (25 residues), see Phobius details amino acids 464 to 491 (28 residues), see Phobius details amino acids 512 to 534 (23 residues), see Phobius details amino acids 550 to 571 (22 residues), see Phobius details amino acids 598 to 618 (21 residues), see Phobius details amino acids 624 to 642 (19 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 646 to 709 (64 residues), 67.1 bits, see alignment 6e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_5420)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBY0 at UniProt or InterPro

Protein Sequence (889 amino acids)

>BPHYT_RS26930 mechanosensitive ion channel protein (Burkholderia phytofirmans PsJN)
MRKLFPIWLVFLLAFIAAPVFAATAPAAPASSASGVGVTLTPEQARQALAVLNDPKRRAQ
VADTLQAIAAAGALSAPPASAPAAASAPTAASGAAALVPAAFKSNGLASQLARQGAHWAV
HLGTSLRSSIAALLDVASVRAWWNWQSTNPQARAVLGHVAWSLLAALIPALVLEWLARRL
LRRAYRALAARRELEEEDDAARADLPVDVAPQPADAPNAAPPLPASPASPVSAAQAQAEA
APAGTSAATKAKGKVNEAKGKQNAKHHWTLLRRLPRALLTMVLRLLPLVVFVGAASALMS
IFTDDGTPQDRALDSLVDIYVLCRVIVIVSGFFLQPAAPRLRLLRMSDAWAAFMQRWVVR
IVSVVGAGSAIAEIAQSLGLNDAAHLALMKVVALAGHVLISILLLQCANPVGELIRKRVA
ERKSLEIVGNVFAEVWAWAAVFVVMALWFVWALDVQNGYHALLHLGGISLAVLVGARVVS
IVVFGALARLFNVQDDATKSLVHLHAYRYYPLLRRVVAWVIGVVTALALLQVWGVHVVDL
FRTGTIGHRLASAIITIGVAAVIALLVWEGVNVSVEQRLDRWTASGDLVRAARLRTLLPM
LRSALFCAIALVVVLTGLSELGVNIGPLLAGASIFGVALGFGSQKLVQDFITGIFLLMEN
AMQVGDWVTLAGVSGTVEYLSIRTVRLRGGDGSLYTVPFSSVSTVNNTNRGIGNAAVKVN
IVFGQDVDLAIDTLKEIGAALREDDKFKDGILSDFSFWGVDALDGSAITLAGQIQCRDSA
RWGVQREFNRRILFQFQERGIEIANPQRNLLTWDPESAPARIEADDAHKDGPGSSSTTQN
ESPASAPSTDAADAGGKADAPVEDQLPVDPKPAGGPGTPANPGSTSPHE